PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn303311
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 251aa    MW: 27847.8 Da    PI: 8.9519
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn303311genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.41.4e-39741704100
      DUF260   4 aCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                 aCk+lrr+Ca++C+++pyf  ++p+kf +vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i++lqq++++l+ael+++++e
  Achn303311  74 ACKLLRRRCAEECPFSPYFSPHEPHKFSAVHKVFGASNVSKMLMEVPESQRADAANSLVYEANVRLRDPVYGCMGAISALQQEVQSLQAELNAVRAE 170
                 9********************************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.79270171IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-3973168IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MRYLQSKLVS MHMLQQYKLQ IGYITHQKTK VSNDCSEKKE GERLGESWSS RVCFDYTLFL  60
DQFVRLQSRG KNRACKLLRR RCAEECPFSP YFSPHEPHKF SAVHKVFGAS NVSKMLMEVP  120
ESQRADAANS LVYEANVRLR DPVYGCMGAI SALQQEVQSL QAELNAVRAE ILRLKYRETA  180
NNIIASTHAA LATPHAVSVA VLQPPSAPPP PLPPSVVVSS SEGSSNLYNP MPASTMGYNS  240
IPSDGVPYFH *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002269676.13e-75PREDICTED: LOB domain-containing protein 15
TrEMBLA0A068U7A72e-76A0A068U7A7_COFCA; Uncharacterized protein
STRINGVIT_06s0004g07790.t011e-74(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.12e-63LOB domain-containing protein 13